Abstract
Polarized membrane addition is crucial for axon development and elongation during neuronal morphogenesis. This process is believed to be regulated by directed membrane trafficking of Rab10-containing post-Golgi carriers. However, the mechanisms underlying the biogenesis of these carriers remain unclear. Here, we report that Rab10 interaction with myosin Vb (MYO5B) determines the formation of Rab10 carriers and is important for axon development. Rab10 interacts with the exon D-encoded domain of MYO5B. Downregulating the expression of MYO5B (+D) or blocking its interaction with Rab10 impairs the fission of Rab10 vesicles from trans-Golgi membranes, causes a decrease in the number of Rab10 transport carriers and inhibits axon development in cultured hippocampal neurons. Furthermore, the MYO5B–Rab10 system is required for axon development of vertebrate neocortical neurons or zebrafish retinal ganglion cells in vivo. Thus, specific interaction between Rab10 and MYO5B controls the formation of Rab10 vesicles, which is required for axon development.
Similar content being viewed by others
Introduction
Axon development requires asymmetric cytoskeletal dynamics as well as new membrane addition from the intracellular supply1,2,3,4. It is believed that plasmalemmal precursor vesicles (PPVs) provide the sources of lipids and proteins required for this membrane supply3. Recently, we have shown that Lgl1, the mammalian homolog of Drosophila tumor suppressor Lethal giant larvae, controls directional membrane insertion during neuronal polarization, by promoting membrane recruitment and activation of Rab10 (ref. 5). Like other vesicles, intracellular trafficking of Rab10 carriers may also need coordination of the following consecutive steps: initiation from a donor membrane, transportation along cytoskeletal tracks, and their tethering and fusion with the acceptor membrane.
Indeed, different members of Rab family small GTPases are involved in trafficking, targeting and fusion of transport vesicles to acceptor compartments through distinct or shared effectors6,7,8. Among around 70 mammalian Rabs, Rab10 has been shown to mediate trafficking of membrane proteins to the plasmalemma in non-neuronal cells9. Recently, we found that Rab10 marks a type of PPV required for polarized membrane insertion during axon development5. Like other post-Golgi carriers, Rab10 vesicles should also derive from trans-Golgi membranes, a step that involves donor membrane deformation or budding, sorting and fission from the trans-Golgi cisternae. However, mechanisms regulating the biogenesis of Rab10 vesicles remain unknown.
Myosins are generally considered as a family of motor proteins that transport cargos along actin filaments. At least 18 distinct classes of myosins have been identified and each of them exhibits particular cellular localization and functions10,11,12. Among them, the best characterized class is myosin V (MYO5), a family of processive molecular motor with two motor domains connected to extended necks and the globular tails that mediate association with various cargos13,14. In mammals, there are three isoforms of MYO5—MYO5A, MYO5B and MYO5C15, with each subjecting to alternative splicing in a tissue-specific manner16,17,18. A number of studies have shown roles of MYO5 in neuronal transportation, exocytosis and synaptic plasticity19. For example, MYO5A transports endoplasmic reticulum vesicles20, secretory vesicles21, tetanus toxin22 or mitochondria23 in axons and mRNA/protein complex into dendritic spines24. Moreover, MYO5 controls exocytosis of large dense core vesicles25 and the recycling of AMPA-type glutamate receptors to dendritic spines26,27,28.
Here, we find that MYO5B interacts with Rab10 residing on trans-Golgi membranes through exon D, and this interaction determines fission of post-Golgi Rab10 carriers. Blocking MYO5B interaction with Rab10 inhibits polarized membrane insertion, as well as axon development. Thus, we conclude that MYO5B controls biogenesis of Rab10 vesicles that are required for neuronal polarization and axon development.
Results
MYO5B exon D binds to GTP-bound form of Rab10
In a proteomic screening based on mass spectrometry analysis (MS) for Rab10 effectors, we identified MYO5B from rat brain homogenates as one of the interesting hits (data not shown), confirming that MYO5 interacts with Rab10 (ref. 18). Immunoprecipitation (IP) of cultured rat cortical neurons with anti-MYO5B antibody caused co-IP of Rab10, indicating the association between Rab10 and MYO5B in the brain (Fig. 1a). Given that exon D of MYO5 is required for its interaction with Rab10 (ref. 18), we determined MYO5 splicing isoforms in the brain. We found that two isoforms of MYO5B with and without exon D are expressed in the rat brain, whereas MYO5A lacks exon D and MYO5C is not expressed in the brain (Fig. 1b). Notably, the sequence of exon D is conserved among different species (Fig. 1c). We confirmed the interaction between Rab10 and MYO5B isoforms co-expressed in HEK 293 cells. As shown in Figure 1d, hemagglutinin (HA)-tagged Rab10 was co-precipitated strongly with GFP-tagged MYO5B (+D), and weakly with MYO5B (−D). The weak association between Rab10 and MYO5B (−D) might be mediated indirectly by common effectors shared by Rab10 and other Rabs, such as Rab11 Family Interacting Protein 2 (FIP2)18,29. To determine whether exon D itself is able to bind Rab10, we used beads coupled with glutathione S-transferase (GST)–Rab10 fusion protein to pull-down affinity-purified hexahistidine (His6)-tagged exon D. As shown in Fig. 1e, exon D preferentially binds to Rab10 preloaded with GTPγS, suggesting the direct interaction between Rab10 and exon D and that MYO5B might be an effector of Rab10. There was no direct interaction between MYO5B exon D and Rab8, Rab11 or Rab13 (Fig. 1f), indicating the specificity of exon D interaction with Rab10. When expressed in fibroblasts, tdTomato-tagged Rab10 (TD-Rab10) exhibited vesicular localization and was largely colocalized with GFP-tagged MYO5B (+D) (Supplementary Fig. S1a,b). However, the percentage of Rab10 colocalized with GFP-MYO5B (−D) was significantly decreased (Supplementary Fig. S1a,b), in line with the notion that exon D is required for the interaction with Rab10 (ref. 18).
MYO5B–Rab10 interaction determines neuronal polarization
Isolated hippocampal neurons from rat embryos undergo spontaneous axon development in culture30,31. Shortly after adherence to the culture substratum, these neurons extend several short neurites with similar length (Stage 2). After 24–36 h, however, one of the neurites exhibits accelerated growth and later becomes the axon (Stage 3). The transition from Stage 2 to Stage 3 is a critical period for axon specification, and this process needs asymmetric membrane supply that involves Rab10-positive vesicles5. Interestingly, we found that TD-Rab10 was largely colocalized with GFP-MYO5B (+D) in the somatic region, especially in perinuclear areas proximal to axon initiation sites in polarized hippocampal neurons (Fig. 1g). Notably, much lesser Rab10 was colocalized with MYO5B (−D) (Fig. 1g), indicating that exon D domain is required for the interaction with Rab10 in neurons. To determine roles of MYO5B isoforms in axon development, we downregulated the expression of MYO5B (+D) by using small interfering RNAs (siRNAs). Because of the lack of antibody that can distinguish MYO5B (+D) and MYO5B (−D), we chose to test the efficacy of siRNAs by measuring levels of mRNAs of respective MYO5B isoforms using reverse transcription PCR (RT-PCR). As shown in Fig. 2a, the expression of mRNA of endogenous MYO5B (+D), but not that of MYO5B (−D), was suppressed by the siRNA specifically targeted against exon D of MYO5B (siMYO5B) in cultured cortical neurons. We found that transfection of cultured hippocampal neurons before cell plating with siMYO5B plasmids impaired axon formation (Fig. 2b). The effect of siMYO5B on axon formation was reflected from the reduced percentage of neurons with single axons, which positively stained with SMI-312, as compared to cultures transfected with plasmid encoding scrambled sequence (siScramble) (Fig. 2b). The defect in axon formation of siMYO5B neurons was markedly prevented by co-transfection with siRNA-resistant form of MYO5B (+D), hereafter referred to as MYO5B (+D)-Res, but not by MYO5B (−D) (Fig. 2b). This result indicates the importance of exon D domain for the function of MYO5B in axon development. To determine whether the motor activity of MYO5B is required for axon development, we generated mutated forms of MYO5B in the background of MYO5B (+D)-Res. Both the S217A mutation in switch I and the G440A/E442A double mutations in switch II inhibit ATP hydrolysis activity, and thus exhibit reduced run length on actin filaments32,33,34. Interestingly, neither S217A nor G440A/E442A could rescue axon developmental defect caused by siMYO5B (Fig. 2b). Thus, the motor activity of MYO5B is required for its function in regulating axon development.
To further determine the role of Rab10–MYO5B system in axon development, cultured hippocampal neurons were transfected with GFP-exon D plasmid to block the interaction between endogenous Rab10 and MYO5B (+D). Similar to the effect of siMYO5B, overexpression of exon D also caused a decrease in the percentage of polarized cells with single axon (Fig. 2d). Thus, MYO5B interaction with Rab10 determines neuronal polarization in culture hippocampal neurons.
Rab10–MYO5B interaction determines Rab10 vesicle formation
How does the interaction between Rab10 and MYO5B affect axon development? A reasonable hypothesis is that MYO5B may determine transport of Rab10 vesicles required for directional membrane insertion. However, Rab10 vesicles were not well colocalized with MYO5B (+D) in the shafts or growth cones of neurites or axons of cultured hippocampal neurons (Fig. 1g). In contrast, Rab10 and MYO5B (+D) were largely colocalized in the perinuclear regions (Fig. 1g), which were enriched with trans-Golgi network signal TGN38 (Supplementary Fig. S2a). Notably, immuno-electron microscopy (EM) showed that Rab10 and IGFR-β, the receptor for insulin-like growth factor, which is believed to be a marker for PPV35, were observed in the Golgi or perinuclear membrane structures of the rat cortex (Supplementary Fig. S2b,c). These findings prompted us to determine the role of Rab10–MYO5B system in the biogenesis of post-Golgi Rab10 carriers. We found that in cultured hippocampal neurons at DIV1, TD-Rab10 exhibited vesicular distribution and a pool of Rab10 was colocalized with TGN38 (Fig. 3a; top rows). Interestingly, when MYO5B (+D) was downregulated, the number of Rab10 vesicles was markedly reduced (Fig. 3b), and more Rab10 was accumulated at TGN regions, as indicated by increased colocalization between Rab10 and TGN38 (Fig. 3c). Of note, downregulation of MYO5B had no apparent effect on the distribution of TGN38 (Fig. 3e). The decrease in the number of Rab10 vesicles and increase in the accumulation at TGN were prevented by co-expression of MYO5B (+D)-Res, but not mutants with impaired motor activity, or MYO5B (−D) (Fig. 3b–d). Thus, the motor activity and exon D domain of MYO5B are crucial for the formation of post-Golgi Rab10 carriers.
Next, the role of Rab10–MYO5B interaction in the formation of Rab10 vesicles was determined by overexpressing exon D or treating cultured neurons with cell permeable peptides composed of the TAT sequence derived from the trans-activator of transcription of human immunodeficiency virus and the exon D or scrambled sequence. Similar to the effect of siMYO5B, overexpression of exon D also caused a marked reduction in the number of Rab10 vesicles (Fig. 3f) and increased accumulation of Rab10 in TGN regions (Fig. 3h), without affecting TGN (Fig. 3j). Moreover, treatment with TAT-exonD (40 μM, 1.5 h), which was able to acutely disrupt the association between Rab10 and MYO5B (Supplementary Fig. S1c,d), also caused similar effects on patterns of Rab10 distribution (Fig. 3k–o). We also evaluated localization of endogenous Rab10 by immunostaining after above treatments and found similar tendency (Supplementary Fig. S3a–f). These results suggest that MYO5B and its interaction with Rab10 are important for the formation of Rab10 vesicles, whose directional membrane insertion is critical for neuronal polarization.
The failure in the formation of Rab10 vesicles in siMYO5B or exon D neurons might perturb polarized distribution of Rab10. Using Tuj1 (β-Tubulin III) as a marker for neurite volume, we found that Rab10 intensity was indeed significantly higher in the axon than in other neurites of cultured hippocampal neurons at DIV 3 (Supplementary Fig. S4a–d, see red arrow heads). However, in siMYO5B or exon D-transfected neurons, this polarized distribution of Rab10 was impaired, with Rab10 signals evenly distributed to all neurites (Supplementary Fig. S4c,d). The impairment in polarized distribution of Rab10 caused by siMYO5B was prevented by co-expression of MYO5B (+D)-Res, but not MYO5B (−D) (Supplementary Fig. S4a,c). The failure in the formation of Rab10 vesicles may also lead to impairment in polarized membrane insertion of PPV-associated membrane proteins to the plasma membrane. What types of membrane proteins are contained in Rab10 vesicles? Immune-EM analysis showed that in the P0 rat brain sections covering the regions of callosal commissure, the pleiomorphic Rab10 vesicles were co-labeled by IGFR, TrkB or VAMP4 (Fig. 4a). Interestingly, in cultured hippocampal neurons transfected with siMYO5B or exon D, IGFR failed to be localized to the cell surface (Fig. 4b), although total levels of IGFR remained unchanged (Supplementary Fig. S5a). In contrast, in control cells transfected with siScramble and vehicle plasmids, surface or total IGFR was found in distal regions of axons (Fig. 4b and Supplementary Fig. S5a, see red arrowheads). We also found marked accumulation of IGFR in the cell body of siMYO5B-transfected cells (Supplementary Fig. S5b,c, see red arrows), suggesting the failure to exit Golgi. Thus, MYO5B and its interaction with Rab10 have an important role in the formation of post-Golgi carriers, which exhibit polarized distribution during axon development.
MYO5B–Rab10 interaction determines Golgi fission of PPVs
Formation of post-Golgi carrier vesicles involves remodeling, elongation and fission at the trans-Golgi network. Next, we determined which specific step MYO5B participates in regulating the formation of Rab10 vesicles. We found that endogenous vesicular Rab10 distributed in regions from perinuclear to cell periphery of fibroblasts (Fig. 5a). A pool of Rab10 was colocalized with TGN38 in perinuclear regions (Fig. 5a). We followed the dynamics of the Rab10-labeled vesicles using time-lapse microscopy, under the conditions without or with MYO5B downregulation. In control cells transfected with TD-Rab10 and vehicle plasmids, we often observed the dynamic process for the formation of Rab10 vesicles, which are composed of the following consecutive steps—membrane extension from the perinuclear to form a tubular structure, fission of tubules to form carrier vesicles, followed by transportation of the carrier vesicle to the cell periphery and retraction of the original tubule (Fig. 5b, top row, and ,Supplementary Movie 1). Interestingly, when expression of MYO5B (+D) was downregulated, more tubular structures emerged from perinuclear regions. Usually, these tubules persisted for several minutes without fission during the observation periods (Supplementary Movie 2 and Fig. 5b, the second row from top). As a result, the static number of TD-Rab10 tubules was increased in siMYO5B cells, compared with control cells transfected with siScramble and vehicle plasmids (Fig. 5c). Notably, siMYO5B transfection also caused an increase in the percentage of cells exhibiting TD-Rab10 tubules in cultured cortical neurons (Supplementary Fig. S6a,b, see also Supplementary Movie 5 and 6) and endogenous Rab10 tubules in fibroblasts (Supplementary Fig. S7a,c). Sometimes, these unfissioned Rab10 attached together to form big vacuoles (Supplementary Fig. S6 and Supplementary Movie 6), and this phenomena was never seen in control cells. Thus, MYO5B (+D) is essential for the formation of Rab10 vesicles, most likely at the step of membrane fission, rather than the steps of deformation or elongation of TGN membranes. In line with the role of MYO5B (+D) in the fission of Rab10 vesicles from TGN, the number of Rab10-postive vesicles undergoing transportation after fission was decreased in siMYO5B cells (Fig. 5c). Notably, either the increase in tubular structures or the decrease in transport vesicles caused by siMYO5B was largely prevented by expression of MYO5B (+D)-Res, but not MYO5B (−D) (Fig. 5b–e, also see Supplementary Movies 3, 4, 7 and 8, Supplementary Figs S6, and S7c). Thus, exon D domain of MYO5B is essential for the sorting of Rab10 vesicles from the TGN membranes.
Similar to the effect of siMYO5B, overexpression of exon D caused appearance of tubular structures of endogenous or TD-Rab10 in fibroblasts (Fig. 6a and Supplementary Fig. S7) or neurons (Supplementary Fig. S6 and Supplementary Movie 9). The fission defect resulting from exon D overexpression was also reflected from increased number of TD-Rab10 tubules (Fig. 6b), percentage of cells with endogenous Rab10 tubules (Supplementary Fig. S7b,d), percentage of cortical neurons with TD-Rab10 tubules (Supplementary Fig. S6 and Supplementary Movie 9) and decreased number of Rab10 carrier vesicles (Fig. 6c). Treatment with TAT-exonD also caused an increase in the number of tubules and a decrease in Rab10 vesicles, in a dose-dependent manner (Fig. 6d–f). Thus, the MYO5B–Rab10 interaction have an important role in the fission of deformed and elongated membrane structures of the Golgi apparatus.
Next, we analyzed ultrastructural changes in the fibroblasts transfected with exon D or siMYO5B by electroporation, which resulted in the transfection of almost all the cells. (Supplementary Fig. S8). EM analysis showed that siMYO5B or exon D transfection caused abnormal accumulation of tubular or vesicular structures with heterogeneous shapes and sizes in perinuclear or periphery cell regions (Fig. 6g, see tubules indicated by blue arrows). Some vesicular structures might be the cross sections of tubules. Thus, MYO5B determines biogenesis of Rab10 transport vesicles through the interaction with Rab10.
MYO5B–Rab10 system in axon development of cortical neurons
We next determined the physiological role of this regulatory mechanism in vivo. For this purpose, E16.5 rat embryos were subjected to in utero electroporation with combinations of siRNA or expression plasmids together with pCAG-EYFP to label cortical neural precursors, and then at P0, differentiation of transfected cells was determined by staining with antibodies recognizing newborn neurons at different stages and staining with GFP antibody for cell morphology. We found that in control animals that had been transfected with scrambled siRNA, transfected cortical neurons extended contralateral projecting axons traversing through the intermediate zone (IZ) toward the midline (Fig. 7a, see a1). However, such axon projection was severely affected in siMYO5B-transfected animals (Fig. 7a, see a2), as reflected from decreased axon length index (Fig. 7b). The impairment in axon development caused by MYO5B downregulation was completely prevented by co-expression of MYO5B (+D)-Res (Fig. 7a (see a3) and 7b). Same approach was used to determine the effect of exon D overexpression. Cortical neurons transfected with exon D also exhibited reduced length of the callosal axons (Fig. 7c). Thus, Rab10 interaction with MYO5B has a critical role in axon development of cortical neurons in vivo.
The observed defects in axon projection could be caused by abnormal neuronal fate determination or morphogenesis. We thus determined neuronal fate by staining with antibodies against NeuN, a marker for mature neurons, or Ki67, which labels proliferating cells. We found that the percentage of Ki67- or NeuN-positive cells among GFP-labeled transfected cells was not affected by electroporation with siMYO5B or exon D plasmids, compared with vehicle controls (Figs. 7e–h). Thus, MYO5B–Rab10 system does not regulate neuronal fate or cell proliferation.
In addition to the effects on axon projection, newborn cortical neurons with siMYO5B or exon D expression also exhibited defects in neuronal migration, because lesser siMYO5B or exon D-electroporated cortical neurons migrated to the cortical plate (CP) (Fig. 7a). The migration defects were most likely caused by abnormal neuronal morphogenesis. We analyzed morphology of NeuN+ neurons located in the IZ and CP regions. Interestingly, whereas most neurons of control animals exhibited polarized structure with a short leading process destined to become apical dendrite and a long trailing process destined to become axon, most neurons in animals transfected with sMYO5B or exon D failed to polarize normally (Fig. 7i). Thus, MYO5B–Rab10 system is needed for the polarization of neocortical neurons in vivo.
MYO5B–Rab10 system in zebrafish optic nerve development
Retinal ganglion cells (RGCs) provide another model for the study of axon development in vivo36,37,38. Upon contacts with basal laminin, the basal processes of newborn RGCs tend to form axons39. To determine whether the role of MYO5B–Rab10 system in axon development is conserved in other species, we analyzed axon growth of larval zebrafish RGCs after injection with morpholino oligos (MOs) against MYO5B or Rab10. As shown in Fig. 8a, RT-PCR shows that the fish MYO5B also has +D and –D isoforms, and the splice MO specific for exon D was effective in knocking down the expression of +D, but not –D isoform. The fish Rab10 has similar molecular weight with the mouse or rat homolog (Fig. 8b). We designed two MOs to suppress the expression of Rab10. ATG MO was designed to knockdown the translation of Rab10, and splice MO was designed based on intron–exon boundary region of Rab10 to block its splicing of transcription. Both MOs were able to suppress the expression of Rab10, in either translation or transcription levels (Fig. 8c). RGCs were labeled by mCherry driven by RGC precursor-specific Ath5 promoter (Fig. 8e)40. As shown in Fig 8e, the control fish at 2 days post-fertilization (dpf) showed normal optic chiasm that is composed of optic nerves (indicated by red arrows) traversing to the contralateral side of the brain. However, in larvae injected with MOs against MYO5B or Rab10, optic axonal tracts were severely impaired (Fig. 8e), as reflected from decreased percentage of larvae with visible axon tracts (Fig. 8f). Notably, even for those larvae with axon tracts, the width of optic axonal tracts was markedly reduced in larvae injected with MYO5B or Rab10 MOs (Fig. 8g). These results support the conclusion that MYO5B–Rab10 system is important for axon development in various species.
To determine whether MYO5B–Rab10 interaction is important for axon development of zebrafish RGCs, TAT-exonD or scrambled peptides were injected into the right eye of Tg (Ath5:gal4-uas-mCherry) transgenic fish at 1 dpf, and optic nerves were observed at 2 dpf (Fig. 8h). Interestingly, majority of larvae injected with TAT-exonD exhibited an abnormal optic chiasm with optic nerves from the injected eye completely impaired and the uninjected eye unaffected (Fig. 8i). As a control, injection with TAT-scramble peptides had no effect on the formation of optic chiasm (Fig. 8h). We also compared the axon fibers of RGCs from two eyes of the same animal (Fig. 8k). We found that in the TAT-exonD-injected group, even for those larvae with optic chiasm, the width of optic axon tracts from the right eye with peptide injection was markedly decreased compared with that from the left eye without injection (Fig. 8i (see impaired optic nerves indicated by red arrow) and 8k). This difference was not observed for animals injected with TAT-scrambled peptides (Fig. 8h). We next asked whether the impairment in RGC axons was due to the effect on cell health. We compared the intensity of mCherry, which was used to reflect relative number of RGCs, and found that neither injection with TAT-exonD nor TAT-scrambled peptides had caused any difference in the intensity of mCherry between the left and right eyes (Fig. 8l). Thus, the interaction between MYO5B and Rab10 have a critical role in the formation or maintenance of RGC axons.
Discussion
Axon specification and growth need the coordination between cytoskeleton dynamics and membrane trafficking1,2. Many molecules regulating cytoskeleton organization have been identified to be involved in neuronal polarization1,2. On the other hand, membrane trafficking mechanisms governing neuronal polarization are just beginning to be understood5,41,42. Recently, we have shown that Lgl1 has an important role in directional membrane insertion underlying axon development by activating Rab10 (ref. 5). Here, we have demonstrated an unexpected role of MYO5B in the biogenesis of post-Golgi Rab10 carriers and determined its role in axon development.
Based on the previous study18 and a proteomic screening, we have focused on MYO5B. We found that MYO5B binds to GTP-bound form of Rab10 via exon D, and interestingly, downregulating the expression of MYO5B (+D) or blocking its interaction with Rab10 inhibits fission of post-Golgi Rab10 carriers from the Golgi membrane. We propose a model that Rab10 residing on the Golgi is recognized by exon D domain of MYO5B, which determines sorting of Rab10 carriers. How does MYO5B promote vesicle fission at the Golgi? An attractive hypothesis is that mechanochemical properties of MYO5B may control Golgi membrane tension and deformation, thereby promote fission at the Golgi membrane. In support of this hypothesis, motor activity of MYO5B is essential for the formation of Rab10 vesicles and axon development. In line with this model, myosin Ib has been shown to be a molecular force sensor43,44, and promotes the formation of tubular-carrier precursors45. Another example is myosin II, which has been shown to control fission of Rab6 vesicles at the Golgi complex46. A number of molecules, such as dynamin 2, BARS, PKD or FAPP2, have been shown to act as fission-promoting factors47,48,49,50,51,52,53. It remains possible that some of these proteins may also participate in the fission of Rab10 vesicles.
It is believed that axon growth requires polarized new membrane insertion3,54. In line with this notion, the Golgi apparatus is associated with the sites of axon specification55,56. It seems that several types of vesicles provide the source of the membrane precursors5,41,57,58,59. The possible interaction between these vesicular systems makes the dissection for the contribution of each system very difficult. In this work, we have investigated the role of post-Golgi Rab10 carriers in axon development by blocking the interaction between Rab10 and MYO5B. This study has provided evidence that Rab10 vesicle formation is indeed needed for neuronal polarization. Like other vesicles, Rab10 vesicles also need to be transported along neurite shafts and docked and fused with acceptor membranes. It is of great interest to identify motors, adapters and membrane machineries that are responsible for the trafficking of post-Golgi Rab10 carriers at various steps.
Methods
Reagents
Beads used for affinity purification were from GE (Glutathione-sepharose), Roche (protein A or protein G agarose) or Qiagen (Ni-NTA). Antibodies used for immunostaining (IS), immunoblotting (IB), or immune-electron microscopy (EM) were from Protein Tech Group (Rab10, 1:200 for IS or 1:300 for IB), Santa Cruz (GFP, 1:500 for IB; MYO5B, 1:200 for IB), Sigma (HA, 1:5,000 for IB; Actin, 1:5,000 for IB), Abcam (His, 1:1000 for IB, VAMP4, 1:100 for EM), Abmart (GFP, 1:2,000 for IB; Rab10, 1:200 for EM), Invitrogen (GFP, 1:1,000 for IS), Covance (SMI-312, Tuj1, 1:1,000 for IS), KangChen (GAPDH, 1:5,000 for IB), BD (Rab8, 1: 500 for IB; TGN38, 1:300 for IS), Upstate (Rab11, 1:500 for IB), Millipore (TrkB, Rab13, 1:500 for IB) or Cell signaling (IGFR-β, 1:300 for IS, 1:100 for EM). Alexa 488-, Alexa 555- or Alexa 647-conjugated secondary antibodies (1:2000 for IS) were from Invitrogen. HRP-conjugated secondary antibodies (1:4,000 for IB) were from Millipore. TAT-exon D or scrambled peptides were synthesized by GL Biochem (Shanghai) with the following sequences of amino acids: TAT-exonD, N′-YGRKKRRQRRRGSQTEDWGYLNEDGELGLAYQGLKQVA-C′; TAT-scramble, N′-YGRKKRRQRRRGLWAGLDNEAQSKTEQVYQGELGYTGL-C′. MOs were purchased from Gene Tools (Philomath, OR), with following sequences: MYO5B splice MO, 5′-GCTTTACTGCCATCCGAGTGCAAGA-3′; Rab10 ATG MO, 5′-ATAGGTCTTCTTCGCCATCTGAGCT-3′; Rab10 splice MO, 5′-ATCCCTGCACAAACACAACCACAAT-3′, control MO, 5′-CCTCTTACCTCAGTTACAATTTATA-3′.
Full blots or gels for images shown in main figure panels can be found in Supplementary Fig. S9.
Constructs
siRNA was designed against the exon D region of rat MYO5B with following sequence: 5′-GGCTTACCAAGGCCTAAAGCA-3′. The siMYO5B or the scramble sequence (5′-GGACCAGCCGAATTAGCTACA-3′) was synthesized and subcloned into pGPU6 vector. The construct encoding HA-tagged Rab10 or GFP-tagged MYO5B was introduced in our previous studies5,60. Exon D region of MYO5B was deleted by using Quick Change Kit (Stratagene) to form the MYO5B (−D) construct. The mutants S217A and G440AE442A were made by using Quick Change Kit (Stratagene) on the base of MYO5B (+D)-Res construct. TdTomato was subcloned into the HindIII site of pKH3-Rab10 to generate TD-Rab10.
Recombinant protein purification
Exon D of MYO5B was subcloned into pET32a vector. His6-exon D or GST-Rab10 recombinant fusion proteins were expressed in E. coli BL21 (DE3), followed by affinity purification using Ni-NTA agarose or Glutathione-sepharose, respectively.
Immunoprecipitation and pull-down assay
HEK 293 cells were cultured in DMEM supplemented with 10% fetal bovine serum (FBS) and transfected by lipofectamine 2000. Cell lysates were prepared in the cold lysis buffer (50 mM Tris (pH 7.5), 150 mM NaCl, 1% Nonidet P40) with protease inhibitors cocktail (Merck). For immunoprecipitation (IP), cell lysates (0.5–1 mg of protein in a final volume of 1 ml) were incubated with respective antibodies (1–3 μg) and subsequently with 40 μl protein A or protein G agarose beads. Immunoprecipitated proteins were resolved by SDS-PAGE, followed by IB. For guanine nucleotide selective binding assay, GST-Rab10 (5 μg) was incubated with His6-ExonD, in the presence of either 5 μM GDP or GTPγS, respectively, for 2 h at room temperature in a buffer containing 25 mM Tris (pH 7.5), 150 mM NaCl, and 5 mM MgCl2. Glutathione-sepharose beads were added to the mixture, incubated for 30 min, and washed with the wash buffer (25 mM Tris (pH 7.5), 150 mM NaCl, 5 mM MgCl2 and 100 mM EDTA) for at least three times, and followed by IB.
Cell culture and imaging
Rat fibroblasts were isolated from E18.5 fetal rat skin and cultured in DMEM supplemented with 10% FBS at 37 °C incubator with 5% CO2. Rat hippocampal neurons were prepared from E18 rat embryos and digested with 0.125% trypsin-EDTA for 20 min at 37 °C followed by trituration with pipettes in the plating medium (DMEM with 10% FBS and10% F12), and then plated onto coverslips coated with poly-D-lysine. After culturing for 24 h, media was changed with neuronal culture media (neurobasal media containing 1% glutamate and 2% B27). Fibroblasts or dissociated neurons were transfected by electroporation using the Amaxa Nucleofector device before plating.
For polarity analysis, neurons were fixed and stained 72 h after plating with antibodies against axonal marker SMI-312 or neuronal marker Tuj1. The fixed and stained cultures were examined by using a Neurolucida system (Nikon). For live cells, time-lapse images were acquired at a rate of 1 frame per s with Nikon Eclipse Ti-E inverted microscope with perfect focus system, equipped with CFI Apo TIRF 100 × 1.49 N.A. oil objective (Nikon), and Cascade 512B CCD camera (Photometrics, Roper Scientific). 16-bit images were projected onto the CCD chip at a magnification of 0.16 μm per pixel. For the imaging of subcellular localization, cells were fixed and stained and the fluorescence images were taken using a 60 × Plan Apo objective (NA 1.4 oil) on the NIKON FN1 confocal microscope. For the quantification of vesicle numbers, zoom 2 × is used in the imaging with a resolution of 0.1 μm/pixel. After Z-stack projection, 8-bit images were analyzed using Image J software with threshold set from 140–256. For Rab10 vesicles, the size was set as 1–9 pixels with a resolution of 0.1 μm per pixel (~0.1–0.3 μm in diameter). For accumulated IGFR puncta, the size was set as 25–160 pixels with a resolution of 0.1 μm per pixel (~0.5–1.3 μm in diameter). For the analysis of colocalization between TD-Rab10 and TGN38, the Pearson’s correlation coefficient and % voxels of colocalization of both channels were obtained from the plugin ‘Colocalization analysis—colocalization threshold’ of Image J. Percentage of Rab10 vesicles overlapped with MYO5B vesicles was quantified to indicate colocalization between these two proteins.
Electron microscopy
Cells were fixed for 1 h with 2.5% glutaraldehyde in 0.1 M sodium phosphate buffer, pH 7.4, followed by post-fixation with 1% osmium tetroxide for 30 min, 3 × washes with 0.1 M PBS, dehydration in ascending ethanol series, and finally embedded in araldite over 2 days. Thin sections were stained with methanolic uranyl acetate and lead citrate for morphological examination. Sections were then observed with a Joel JEM-1230 transmission electron microscope. Brain samples from cortex or corpus callosum regions of P0 rats were fixed by 4% paraformaldehyde, 0.1% picric acid and 0.05% glutaraldehyde in 0.1 M PB for 2 h at 4 °C, then cut into 200-μm slices and incubated with 1% osmic oxide for 30 min, dehydrated and embedded in Epon 812. Polymerization was carried out at 37 °C for 12 h, 45 °C for 12 h and 60 °C for 24 h. Ultra-thin sections were cut and collected on nickel grids (200 mesh), followed by staining with primary antibodies (IGFR-β, 1:100; Rab10, 1:200; TrkB, 1:100; or VAMP4, 1:100), 10 × washes with PBS, and staining with secondary antibodies conjugated with 18 nm and 12 nm gold particles (1:50, Jackson ImmunoResearch). Finally, sections were incubated with methanolic uranyl acetate and lead citrate, and observed with a Joel JEM-1230 transmission electron microscope.
In utero electroporation
Rat brains at E16.5 were subject to electroporation, following the injection of mixtures of plasmid DNA in Fast Green (Amresco). Briefly, DNA mixtures containing 9 μg plasmid encoding siRNA against MYO5B or scrambled sequence, 9 μg vehicle or rescue plasmid and 3 μg pCAG-EYFP plasmid were injected into the lateral ventricle of the rat brains at E16.5, which were then subject to electroporation consisting of five square wave pulses (55 V, 100 ms) with an interval of 1 s (ECM830; BTX). Five days post electroporation, coronal cryostat sections of P0 rat cortex were immediately processed for immunostaining by a free-floating protocol. Briefly, brain slices, after treatment with 0.3% Triton X-100 and 5% goat serum in PBS for 1 h, were incubated in primary antibodies (GFP, 1:500; Ki67, 1:100; NeuN, 1:200) for 24 h at 4 °C, followed by 3 × washes with PBS, and incubation with Alexa fluorescence-conjugated secondary antibodies.
Zebrafish experiments
Adult zebrafish (Danio rerio) were maintained in the National Zebrafish Resources of China (NZRC, Shanghai, China) with an automatic fish housing system (ESEN, Beijing, China) at 28 °C. Wildtype and Tg (Ath5:gal4-uas-mCherry) larvae were raised under a 14 h–10 h light-dark cycle in 10% Hank’s solution, which consisted of (in mM): 140 NaCl, 5.4 KCl, 0.25 Na2HPO4, 0.44 KH2PO4, 1.3 CaCl2, 1.0 MgSO4 and 4.2 NaHCO3 (pH 7.2), and were treated with 0.003% 1-phenyl-2-thiourea (PTU, Sigma) to prevent pigment formation. MOs dissolved in nuclease-free water were pressure-injected into one-cell stage embryos at different doses (8 ng for MYO5B splice MO, 2 ng for Rab10 ATG MO, 4 ng for Rab10 splice MO). TAT peptides (10 mM, 8 nl) were pressure-injected into the right eye of larvae at 1 dpf and images were taken from 2-dpf larvae embedded in 1% low-melting point agarose by using Nikon FN1 confocal system with 40 × (W/IR; NA, 0.80) objective lens. All animal experiments were approved by the Animal Care and Use Committee of Institute of Neuroscience, Chinese Academy of Sciences, and in compliance with ethical regulations of Shanghai Institute of Biological Sciences, Chinese Academy of Sciences.
Additional information
How to cite this article: Liu, Y. et al. Myosin Vb controls biogenesis of post-Golgi Rab10 carriers during axon development. Nat. Commun. 4:2005 doi: 10.1038/ncomms3005 (2013).
References
Arimura, N. & Kaibuchi, K. Neuronal polarity: from extracellular signals to intracellular mechanisms. Nat. Rev. Neurosci. 8, 194–205 (2007).
Barnes, A. P. & Polleux, F. Establishment of axon-dendrite polarity in developing neurons. Annu. Rev. Neurosci. 32, 347–381 (2009).
Pfenninger, K. H. Plasma membrane expansion: a neuron's Herculean task. Nat. Rev. Neurosci. 10, 251–261 (2009).
Ye, B. Zhang, Y. W. Jan, L. Y. & Jan, Y. N. The secretory pathway and neuron polarization. J. Neurosci. 26, 10631–10632 (2006).
Wang, T. et al. Lgl1 activation of rab10 promotes axonal membrane trafficking underlying neuronal polarization. Dev. Cell 21, 431–444 (2011).
Zerial, M. & McBride, H. Rab proteins as membrane organizers. Nat. Rev. Mol. Cell Biol. 2, 107–117 (2001).
Grosshans, B. L. Ortiz, D. & Novick, P. Rabs and their effectors: achieving specificity in membrane traffic. Proc. Natl Acad. Sci. USA 103, 11821–11827 (2006).
Stenmark, H. Rab GTPases as coordinators of vesicle traffic. Nat. Rev. Mol. Cell. Biol. 10, 513–525 (2009).
Sano, H. et al. Rab10, a target of the AS160 Rab GAP, is required for insulin-stimulated translocation of GLUT4 to the adipocyte plasma membrane. Cell Metab. 5, 293–303 (2007).
Goodson, H. V. & Spudich, J. A. Molecular evolution of the myosin family: relationships derived from comparisons of amino acid sequences. Proc. Natl Acad. Sci. USA 90, 659–663 (1993).
Mooseker, M. S. & Cheney, R. E. Unconventional myosins. Annu. Rev. Cell Dev. Biol. 11, 633–675 (1995).
Hodge, T. & Cope, M. J. A myosin family tree. J. Cell Sci. 113, (Pt 19): 3353–3354 (2000).
Wu, X. S. et al. Identification of an organelle receptor for myosin-Va. Nat. Cell Biol. 4, 271–278 (2002).
Fukuda, M. Kuroda, T. S. & Mikoshiba, K. Slac2-a/melanophilin, the missing link between Rab27 and myosin Va: implications of a tripartite protein complex for melanosome transport. J Biol Chem 277, 12432–12436 (2002).
Rodriguez, O. C. & Cheney, R. E. Human myosin-Vc is a novel class V myosin expressed in epithelial cells. J. Cell Sci. 115, 991–1004 (2002).
Mercer, J. A. Seperack, P. K. Strobel, M. C. Copeland, N. G. & Jenkins, N. A. Novel myosin heavy chain encoded by murine dilute coat colour locus. Nature 349, 709–713 (1991).
Seperack, P. K. Mercer, J. A. Strobel, M. C. Copeland, N. G. & Jenkins, N. A. Retroviral sequences located within an intron of the dilute gene alter dilute expression in a tissue-specific manner. EMBO J. 14, 2326–2332 (1995).
Roland, J. T. Lapierre, L. A. & Goldenring, J. R. Alternative splicing in class V myosins determines association with Rab10. J. Biol. Chem. 284, 1213–1223 (2009).
Rudolf, R. Bittins, C. M. & Gerdes, H. H. The role of myosin V in exocytosis and synaptic plasticity. J. Neurochem. 116, 177–191 (2011).
Tabb, J. S. Molyneaux, B. J. Cohen, D. L. Kuznetsov, S. A. & Langford, G. M. Transport of ER vesicles on actin filaments in neurons by myosin V. J. Cell Sci. 111, (Pt 21): 3221–3234 (1998).
Bridgman, P. C. Myosin Va movements in normal and dilute-lethal axons provide support for a dual filament motor complex. J. Cell Biol. 146, 1045–1060 (1999).
Lalli, G. Gschmeissner, S. & Schiavo, G. Myosin Va and microtubule-based motors are required for fast axonal retrograde transport of tetanus toxin in motor neurons. J. Cell Sci. 116, 4639–4650 (2003).
Pathak, D. Sepp, K. J. & Hollenbeck, P. J. Evidence that myosin activity opposes microtubule-based axonal transport of mitochondria. J. Neurosci. 30, 8984–8992 (2010).
Yoshimura, A. et al. Myosin-Va facilitates the accumulation of mRNA/protein complex in dendritic spines. Curr. Biol. 16, 2345–2351 (2006).
Bittins, C. M. Eichler, T. W. & Gerdes, H. H. Expression of the dominant-negative tail of myosin Va enhances exocytosis of large dense core vesicles in neurons. Cell Mol. Neurobiol. 29, 597–608 (2009).
Lise, M. F. et al. Involvement of myosin Vb in glutamate receptor trafficking. J. Biol. Chem. 281, 3669–3678 (2006).
Correia, S. S. et al. Motor protein-dependent transport of AMPA receptors into spines during long-term potentiation. Nat. Neurosci. 11, 457–466 (2008).
Wang, Z. et al. Myosin Vb mobilizes recycling endosomes and AMPA receptors for postsynaptic plasticity. Cell 135, 535–548 (2008).
Hales, C. M. Vaerman, J. P. & Goldenring, J. R. Rab11 family interacting protein 2 associates with Myosin Vb and regulates plasma membrane recycling. J. Biol. Chem. 277, 50415–50421 (2002).
Dotti, C. G. Sullivan, C. A. & Banker, G. A. The establishment of polarity by hippocampal neurons in culture. J. Neurosci. 8, 1454–1468 (1988).
Goslin, K. & Banker, G. Experimental observations on the development of polarity by hippocampal neurons in culture. J. Cell Biol. 108, 1507–1516 (1989).
Forgacs, E. et al. Switch 1 mutation S217A converts myosin V into a low duty ratio motor. J. Biol. Chem. 284, 2138–2149 (2009).
Yengo, C. M. De la Cruz, E. M. Safer, D. Ostap, E. M. & Sweeney, H. L. Kinetic characterization of the weak binding states of myosin V. Biochemistry 41, 8508–8517 (2002).
Trivedi, D. V. David, C. Jacobs, D. J. & Yengo, C. M. Switch II mutants reveal coupling between the nucleotide- and actin-binding regions in myosin V. Biophys. J. 102, 2545–2555 (2012).
Pfenninger, K. H. et al. Regulation of membrane expansion at the nerve growth cone. J. Cell Sci. 116, 1209–1217 (2003).
Hinds, J. W. & Hinds, P. L. Early development of amacrine cells in the mouse retina: an electron microscopic, serial section analysis. J. Comp. Neurol. 179, 277–300 (1978).
Zolessi, F. R. Poggi, L. Wilkinson, C. J. Chien, C. B. & Harris, W. A. Polarization and orientation of retinal ganglion cells in vivo. Neural Develop. 1, 2 (2006).
Morgan, J. L. Dhingra, A. Vardi, N. & Wong, R. O. Axons and dendrites originate from neuroepithelial-like processes of retinal bipolar cells. Nat. Neurosci. 9, 85–92 (2006).
Randlett, O. Poggi, L. Zolessi, F. R. & Harris, W. A. The oriented emergence of axons from retinal ganglion cells is directed by laminin contact in vivo. Neuron 70, 266–280 (2011).
Kay, J. N. Link, B. A. & Baier, H. Staggered cell-intrinsic timing of ath5 expression underlies the wave of ganglion cell neurogenesis in the zebrafish retina. Development 132, 2573–2585 (2005).
Dupraz, S. et al. The TC10-Exo70 complex is essential for membrane expansion and axonal specification in developing neurons. J. Neurosci. 29, 13292–13301 (2009).
Namba, T. Nakamuta, S. Funahashi, Y. & Kaibuchi, K. The role of selective transport in neuronal polarization. Dev. Neurobiol. 71, 445–457 (2011).
Laakso, J. M. Lewis, J. H. Shuman, H. & Ostap, E. M. Myosin I can act as a molecular force sensor. Science 321, 133–136 (2008).
Laakso, J. M. Lewis, J. H. Shuman, H. & Ostap, E. M. Control of myosin-I force sensing by alternative splicing. Proc. Natl Acad. Sci. USA 107, 698–702 (2010).
Almeida, C. G. et al. Myosin 1b promotes the formation of post-Golgi carriers by regulating actin assembly and membrane remodelling at the trans-Golgi network. Nat. Cell Biol. 13, 779–789 (2011).
Miserey-Lenkei, S. et al. Rab and actomyosin-dependent fission of transport vesicles at the Golgi complex. Nat. Cell Biol. 12, 645–654 (2010).
De Matteis, M. A. & Luini, A. Exiting the Golgi complex. Nat. Rev. Mol. Cell Biol. 9, 273–284 (2008).
Salvarezza, S. B. et al. LIM kinase 1 and cofilin regulate actin filament population required for dynamin-dependent apical carrier fission from the trans-Golgi network. Mol. Biol. Cell 20, 438–451 (2009).
Kreitzer, G. Marmorstein, A. Okamoto, P. Vallee, R. & Rodriguez-Boulan, E. Kinesin and dynamin are required for post-Golgi transport of a plasma-membrane protein. Nat. Cell Biol. 2, 125–127 (2000).
Cao, H. et al. Actin and Arf1-dependent recruitment of a cortactin-dynamin complex to the Golgi regulates post-Golgi transport. Nat. Cell Biol. 7, 483–492 (2005).
Bonazzi, M. et al. CtBP3/BARS drives membrane fission in dynamin-independent transport pathways. Nat. Cell Biol. 7, 570–580 (2005).
Yeaman, C. et al. Protein kinase D regulates basolateral membrane protein exit from trans-Golgi network. Nat. Cell Biol. 6, 106–112 (2004).
Godi, A. et al. FAPPs control Golgi-to-cell-surface membrane traffic by binding to ARF and PtdIns(4)P. Nat. Cell Biol. 6, 393–404 (2004).
Futerman, A. H. & Banker, G. A. The economics of neurite outgrowth—the addition of new membrane to growing axons. Trends Neurosci. 19, 144–149 (1996).
Gartner, A. et al. N-cadherin specifies first asymmetry in developing neurons. EMBO J. 31, 1893–1903 (2012).
de Anda, F. C. et al. Centrosome localization determines neuronal polarity. Nature 436, 704–708 (2005).
Cocucci, E. Racchetti, G. Rupnik, M. & Meldolesi, J. The regulated exocytosis of enlargeosomes is mediated by a SNARE machinery that includes VAMP4. J. Cell Sci. 121, 2983–2991 (2008).
Gupton, S. L. & Gertler, F. B. Integrin signaling switches the cytoskeletal and exocytic machinery that drives neuritogenesis. Dev. Cell 18, 725–736 (2010).
Martinez-Arca, S. Alberts, P. Zahraoui, A. Louvard, D. & Galli, T. Role of tetanus neurotoxin insensitive vesicle-associated membrane protein (TI-VAMP) in vesicular transport mediating neurite outgrowth. J. Cell Biol. 149, 889–900 (2000).
Chu, B.B. et al. Requirement of myosin Vb.Rab11a.Rab11-FIP2 complex in cholesterol-regulated translocation of NPC1L1 to the cell surface. J. Biol. Chem. 284, 22481–22490 (2009).
Acknowledgements
This work was supported by National Natural Science Foundation of China (31021063 and 30825013). We are grateful to Dr Herwig Baier for the transgenic fish line (Ath: gal4-uas-mCherry). We thank Dr Q. Hu of ION Imaging Facility with microscope analysis and Dr Y. Kong with EM analysis. X.H.X was supported by SA-SIBS Scholarship Program, Shanghai Postdoctoral Scientific Program, Chinese Postdoctoral Science Foundation Project, and K.C. Wong Education Foundation.
Author information
Authors and Affiliations
Contributions
Y.L. performed biochemistry, primary neuron culture, transfection, immunostaining, morphology analysis, zebrafish experiments and analyzed data, packaged figs and wrote part of the manuscript. X.H.X. performed proteomic screening, fibroblast culture, transfection, live-imaging, in utero electroporation, and EM analysis, analyzed data and wrote part of the manuscript. Q.C. participated in zebrafish experiments. T.W. participated in surface staining of IGFR. C.Y.D. participated in proteomic screening. B.L.S contributed MYO5 constructs. J.L.D provided assistance in zebrafish experiments and polished related part of the manuscript. Z.G.L supervised the whole project and wrote the manuscript.
Corresponding author
Ethics declarations
Competing interests
The authors declare no competing financial interests.
Supplementary information
Supplementary Figures
Supplementary Figures S1-S9 (PDF 918 kb)
Supplementary Movie 1
Live-imaging of TD-Rab10 vesicles in fibroblasts co-transfected with vehicle plasmids (1 frame per second). (AVI 5609 kb)
Supplementary Movie 2
Live-imaging of TD-Rab10 in fibroblasts co-transfected with siMYO5B plasmids (1 frame per second). Note the TD-Rab10 tubules originating from perinuclear regions. (AVI 2981 kb)
Supplementary Movie 3
Live-imaging of TD-Rab10 in fibroblasts co-transfected with siMYO5B plus MYO5B (+D)-Res plasmids (1 frame per second). Note that over-expression of MYO5B (+D)-Res prevents TD-Rab10 from forming tubules. (AVI 5567 kb)
Supplementary Movie 4
Live-imaging of TD-Rab10 in fibroblasts co-transfected with siMYO5B plus MYO5B (-D) plasmids (1 frame per second). Note the failure of MYO5B (-D) in preventing the formation of tubules. (AVI 2268 kb)
Supplementary Movie 5
Live-imaging of TD-Rab10 vesicles in cortical neurons co-transfected with vehicle plasmids (1 frame per second). (AVI 2595 kb)
Supplementary Movie 6
Live-imaging of TD-Rab10 in cortical neurons co-transfected with siMYO5B plasmids (1 frame per second). Note the appearance of unfissioned big vacuoles and tubules of Rab10 signals originating from perinuclear regions. (AVI 2385 kb)
Supplementary Movie 7
Live-imaging of TD-Rab10 in cortical neurons co-transfected with siMYO5B plus MYO5B (+D)-Res plasmids (1 frame per second). Note that over-expression of MYO5B (+D)-Res prevents TD-Rab10 from forming tubules. (AVI 1572 kb)
Supplementary Movie 8
Live-imaging of TD-Rab10 in cortical neurons co-transfected with siMYO5B plus MYO5B (-D) plasmids (1 frame per second). Note the failure of MYO5B (-D) in preventing the formation of tubules. (AVI 1309 kb)
Supplementary Movie 9
Live-imaging of TD-Rab10 vesicles in cortical neurons co-transfected with GFP-ExonD plasmids (1 frame per second). Note the TD-Rab10 tubules originating from perinuclear regions. (AVI 1584 kb)
Rights and permissions
About this article
Cite this article
Liu, Y., Xu, XH., Chen, Q. et al. Myosin Vb controls biogenesis of post-Golgi Rab10 carriers during axon development. Nat Commun 4, 2005 (2013). https://doi.org/10.1038/ncomms3005
Received:
Accepted:
Published:
DOI: https://doi.org/10.1038/ncomms3005
This article is cited by
-
Cellular and subcellular localization of Rab10 and phospho-T73 Rab10 in the mouse and human brain
Acta Neuropathologica Communications (2023)
-
Salmonella effector SopD promotes plasma membrane scission by inhibiting Rab10
Nature Communications (2021)
-
Rab10 Disruption Results in Delayed OPC Maturation
Cellular and Molecular Neurobiology (2017)
-
Regulation of post-Golgi LH3 trafficking is essential for collagen homeostasis
Nature Communications (2016)
-
Selected SNARE proteins are essential for the polarized membrane insertion of igf-1 receptor and the regulation of initial axonal outgrowth in neurons
Cell Discovery (2015)
Comments
By submitting a comment you agree to abide by our Terms and Community Guidelines. If you find something abusive or that does not comply with our terms or guidelines please flag it as inappropriate.