Table 2 List of peptides used in T-cell in vitro tests.

From: Codon optimization and improved delivery/immunization regimen enhance the immune response against wild-type and drug-resistant HIV-1 reverse transcriptase, preserving its Th2-polarity

Abbreviated name	Amino acid sequence in the regions of DR mutations	DR mutations (if applicable)	T-cell epitope (if applicable)

RT_wt_opt-in	TPVFAIKKKDSTKWRKLVDFRELNKRTQ
RT_1.14_opt-in	TPVFVIKKKNNTGWRKLIDLRELNKRTQ
PEPTIDES
RT 61–69 wt	---FAIKKKDST----------------	A62V, D67N, S68N	N/A
RT 61–69 dr	---FAIKKKNST----------------	A62V, D67N, S68N	N/A
RT 63–72 wt*	-----IKKKDSTKWR-------------	D67N, S68N, K70G	N/A
RT 63–72 dr*	-----IKKKNNTGWR-------------	D67N, S68N, K70G	N/A
RT 66–76 wt*	--------KDSTKWRKLVD---------	D67N, S68N, K70G, V75I	N/A
RT 66–76 dr*	--------KNNTGWRKLVD---------	D67N, S68N, K70G, V75I	N/A
RT 74–82	----------------LVDFRELNK---	V75I, F77L	N/A

RT_wt_opt-in	RTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYEL
RT_1.14_opt-in	RTKVEELREHLLRWGFYTPDQKHQKEPPFLWMGYEL
PEPTIDES
RT 199–216 wt	RTKIEELRTHLLRWGLTT------------------	I202V, Q207E, L214F, T215Y	N/A
RT 199–216 dr	RTKVEELREHLLRWGFY-------------------	I202V, Q207E, L214F, T215Y	N/A
RT 202–210 wt	---IEELRQHLL------------------------	I202V, Q207E	N/A
RT 202–210 dr	---VEELREHLL------------------------	202V, Q207E	N/A
RT 205–220 wt	------LRQHLLRWGLTTPDQK--------------	Q207E, L214F, T215Y, K219Q	N/A
RT 205–220 dr	------LREHLLRWGFYTPDQK--------------	Q207E, L214F, T215Y, K219Q	N/A
RT 207–215 wt	--------QHLLRWGLT-------------------	Q207E, L214F, T215Y	N/A
RT 207–215 dr	--------EHLLRWGFY-------------------	Q207E, L214F, T215Y	N/A
Peptides covering regions not subjected to DR mutations
RT 465–476	KVVPLTNTTNQK	N/A	CD8+ T-cells^(a)
RT 514–528	ESELVNQIIEQLIKK	N/A	CD8+ T-cells^(b)
RT 528–543	KEKVYLAWVPAHKGIG	N/A	CD4+ T-cells^(c)

*RT 63–72 wt/RT 66–76 wt and RT 63–72 dr/RT 66–76 dr were used in pools called RT 63–76 wt and RT 63–76 dr, respectively.
References: (a) -⁴³; (b) -¹³⁰; (c) –⁶⁵.

Back to article page

Table 2 List of peptides used in T-cell in vitro tests.

Search

Quick links